PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G1467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 551aa    MW: 61181.9 Da    PI: 8.5295
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G1467genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-1659105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
      Gh_D09G1467  59 KGGWTLEEDETLRNAVATFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding61.71.5e-19111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
      Gh_D09G1467 111 KGPWTQEEDDKIVELVSKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 157
                      79******************************.*************97 PP

3Myb_DNA-binding53.55.5e-17163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
      Gh_D09G1467 163 KDAWTLEEELALMNAHRIYGNK-WAEIAKVLP-GRTDNAIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.72254105IPR017930Myb domain
SMARTSM007175.0E-1458107IPR001005SANT/Myb domain
PfamPF002497.6E-1559105IPR001005SANT/Myb domain
SuperFamilySSF466893.52E-1560115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-2161113IPR009057Homeodomain-like
CDDcd001673.92E-1262105No hitNo description
PROSITE profilePS5129432.538106161IPR017930Myb domain
SuperFamilySSF466894.87E-32108204IPR009057Homeodomain-like
SMARTSM007173.2E-18110159IPR001005SANT/Myb domain
PfamPF002491.2E-18111157IPR001005SANT/Myb domain
CDDcd001671.44E-15113157No hitNo description
Gene3DG3DSA:1.10.10.601.7E-27114160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-23161212IPR009057Homeodomain-like
SMARTSM007175.9E-16162210IPR001005SANT/Myb domain
PROSITE profilePS5129422.308162212IPR017930Myb domain
PfamPF002495.1E-15163206IPR001005SANT/Myb domain
CDDcd001675.04E-12165205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MTELKIEERC LENKQLTTAS SSSVSEGGGS AIVKSPAISS PAPTSPNHRR TTGPIRRAKG  60
GWTLEEDETL RNAVATFKGK SWKKIAEFFP DRSEVQCLHR WQKVLNPDLV KGPWTQEEDD  120
KIVELVSKYG PTKWSVIAKS LPGRIGKQCR ERWHNHLNPD IKKDAWTLEE ELALMNAHRI  180
YGNKWAEIAK VLPGRTDNAI KNHWNSSMKK KLDFYLATGK LPPVVKIVLK NEIKDIETPA  240
ATENLLVCSK KESDSTAQTS SGTIDICKPE EDGKDQLESS TPVQDMAATS SIIPSESVET  300
ESAEFKPQSF DANPCSCNSV SVVKFESRRT SSAIVKDKVV ETQLRSDTPT YGPLCYEPPR  360
LQGGTSLDSD NLNKKGMQHE WTITPITSPL SFFTPPCVKG SGFGTQSPES ILRIAAKTFP  420
NTPSIFRKRK TSPNKIGKPN EETTKNRVQL SGEQERTENS REQAQFRDGS ACESPAFQGN  480
SSIGPNCTAF NASPPYRLRS KRTAVFKSVE RQLEFAFDKE RHEDSMKSSN LLVNGSSSIE  540
DCLHATKMEV T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-71582125159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-71582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.135450.0ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738642800.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486072.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A0D2QBQ20.0A0A0D2QBQ2_G
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-161myb domain protein 3r-5